group discussion powerpoint presentation

Researched by Consultants from Top-Tier Management Companies

Powerpoint Templates

Icon Bundle

Kpi Dashboard

Professional

Business Plans

Swot Analysis

Gantt Chart

Business Proposal

Marketing Plan

Project Management

Business Case

Business Model

Cyber Security

Business PPT

Digital Marketing

Digital Transformation

Human Resources

Product Management

Artificial Intelligence

Company Profile

Acknowledgement PPT

PPT Presentation

Reports Brochures

One Page Pitch

Interview PPT

All Categories

Top 11 PowerPoint Templates to Facilitate Multiform Discussions

Naveen Kumar

Have you ever been in a 'war room'? Do you know what it is? If you have never been into one and don't know what it is, don't worry; we will introduce you to this old but modernized secret of the Whitehall basement.

Earlier, it was known as a room used during wars by the military and country leaders to plan new strategies, check enemy movements, and for other important discussions. This term's origin can be traced to 1901. However, later, Winston Churchill used the war room extensively during the blitz and V-weapon war. 

As there have been no wars lately (at least in significant parts of the world), this term is taken over by other sectors like ITs, corporates, finance, and politics to conduct the discussion of important strategies along with plans for their quick implementation. One of its most prominent examples is the movie on Clinton's election campaign—The War Room. 

Unlike old times you can't keep a war room locked for days or months. For Satisfying the modern purpose of the war room, a discussion needs to be real quick, focused, one at a time, and fruitful. For that, you and everyone else need to be well prepared in the room.

Preparation for something comes from understanding what it means. So first, we will understand what discussion is?

Discussion is an open forum to consider questions and doubts related to a topic. The purpose of a discussion is to help the participants (and observers) understand and explore the personal meanings of the topic(s) by interacting with people. Also, it is not to convince people but to put forward your views and understand others. 

However, a fruitful discussion session does not just happen. They are the product of concerned cooperative efforts on the part of all participants. The actions include:

1. Thoughtful preparation

If you are a facilitator, then prepare worksheets for the whole discussion or otherwise, for your part in the discussion. While preparing worksheets, you will become more clear about the topic and design a systematic approach to present it. It should carry all the key points that you will present in the session. Besides, don't forget to hand over a copy to each participant after the session.

Tip: Make the worksheet spacious so that it will be easy for you to add notes during the discussion. You can use different ink/pen/style for this.

2. Set ground rules

At least for the beginning, set some ground rules. Later these can be modified if they do not fit. It is necessary to avoid confusion, especially for terms and basic concepts. Otherwise, participants can use one term in different means. Besides, rules like a discussion period can make it easy to pace and cover important topics. 

3. Discussion and debate are not similar

As mentioned earlier, discussions are not to prove your point. It is more about understanding a different perspective(s) for the same topic. Unlike debate, there are not two opposite sides. Here, all are presented as individuals and a team at the same time.

4. Go open-minded 

You may or may not know about the topic. However, if you know about a topic, still there is a chance that others' point of view may surprise you. If you know nothing, then obviously, you are about to learn something new. Whatever the case, don't strangle yourself. Ask what you don't understand and share what you already know.

5. Communication

It is the most important part of the discussion. Try to keep it simple, light, and at the same time topic-related. The mode of communication will depend on the understanding of the participants. You can prepare a discussion with speech, pre-recorded audio, research paper, or visuals.

Tip: Visuals are the most acceptable and easy method. To enhance it you can add text, speech, audio, and other illustrations in a hybrid with visual means.

Moreover, to amp up your visual representation in a discussion, our riveting PowerPoint presentation templates are the ideal choice. You can use them in any multiform discussion. Besides, you can easily share them with the audience using Google Slides and PowerPoint. 

Let's explore them now!

Template 1: Discussion Business Platform PPT Template

This PPT layout provides a general overview of the various discussions and platforms which can be used to conduct it. It has ample space to describe the vitals, etiquettes, or any other details for a discussion. You can use it to explain any or all discussion methods in a clear and concise manner. Download this PowerPoint theme now!

Download the template

Template 2: Open Discussion Business Conference PowerPoint Template

You can use this presentation template to share the importance and agenda of open discussions among employees. Share venue, each person's role, points to discuss, and more of an open discussion session. Besides, this slide is entirely customizable. Grab it now!

Template 3: Group Discussion PowerPoint Template

Employ this slide to facilitate your group discussions with ease. This presentation slide is crafted by our team of expert designers. Besides, it comes with leverage to edit the text, images, icons, and color schemes to match your presentation agenda. So download and try it now!

Template 4 : Notes Business Discussion PPT Template

Incorporate this discussion template to design comprehensive notes, worksheets, and presentation material for your next session. Showcase your unique thoughts, author text, and other critical factors regarding the topic. Display tips and tricks to make notes during sessions using this flexible PPT design. Download it now!

Template 5: Discussion PowerPoint Presentation Slide

Deploy this well-crafted PowerPoint slide to execute an effective and fruitful discussion session and help peers share their views. Select this customizable discussion template and use it as per your requirements. Download right away!  

Template 6: Discussion Points PowerPoint Presentation Template

Prepare well for your next discussion session using this visually-engaging PPT template. Express your concerns and doubts in great style, confidently leading a discussion session. Grab this customizable PowerPoint design for an easy-going round table discussion session.

Template 7: C ommunity Discussion PowerPoint Template

Here is another professionally outlined discussion template to help you deliver an outstanding session. Present your views, doubts, and researched facts related to the topic in a comprehensive manner with this PPT design. Validate your concerns positively to keep your audience engaged using this customizable PowerPoint template.

Template 8: Discussion PowerPoint Presentation Slide

Incorporate this expert-designed discussion template to provide other participants with a sweeping view of your thoughts. Discuss context, facts, and research results of the topic using this audience-captivating template. Download this PowerPoint slide and customize it as per your needs.

Template 9: HR Team Discussing Leadership Development PPT Slide

Are you an HR professional looking for a template to discuss leadership development strategies? You can use this professional design to expedite discussion sessions with your and the leadership team. Besides, it's easy to edit and present. Download it now!

Template 10: Online Discussion PowerPoint Template

This template can help you share the pros and cons of discussion sessions on video conferencing. You can use it to share the details like venue, participants, schedule, and more about the online discussion forum. Grab it now!

Discussions are important for the expansion of knowledge, embracing new perspectives, and introspection. Moreover, It provides you a chance to learn exciting trivia about unfamiliar things. 

However, a successful discussion comes after the great cooperative efforts of participants. All need to be open to criticism, calm, well-prepared, and in a state of learning to communicate effectively and navigate the discussion in the right direction. 

Our presentation templates can help you describe your ideas comprehensively during a discussion session. Besides, these can be used multiple times. So grab them now!

 P.S: Do you want to learn to present yourself confidentially in a discussion session? Improve your public speaking skills by exploring this all-inclusive guide .

Related posts:

• 7 Tips to Conduct Effective Business Meetings (With Do’s and Don’ts Templates Included)
• Top 11 PowerPoint Templates to Facilitate Question and Answer Sessions [Free PDF Attached]
• 15 Best Crisis Communication Plan Templates For Industry Leaders
• It is Critical That Your Company Has a Good Communication Plan (and Here are Some Templates That Will Help You Present It)

Liked this blog? Please recommend us

Top 10 Logic Model Templates to Conceptualize and Demonstrate Your Project Structure [Free PDF Attached]

Top 20 Complaint Templates for Effective Customer Management [Free PDF Attached]

15 Best Pain Point Templates to Identify and Resolve Business Problems [Free PDF Attached]

Top 10 Business Analyst Templates to Manage and Secure Your Checklists [Free PDF Attached]

This form is protected by reCAPTCHA - the Google Privacy Policy and Terms of Service apply.

Digital revolution powerpoint presentation slides

Sales funnel results presentation layouts

3d men joinning circular jigsaw puzzles ppt graphics icons

Business Strategic Planning Template For Organizations Powerpoint Presentation Slides

Future plan powerpoint template slide

Project Management Team Powerpoint Presentation Slides

Brand marketing powerpoint presentation slides

Launching a new service powerpoint presentation with slides go to market

Agenda powerpoint slide show

Four key metrics donut chart with percentage

Engineering and technology ppt inspiration example introduction continuous process improvement

Meet our team representing in circular format

Home PowerPoint Templates Business PowerPoint Templates Group Discussions & Team Goals Template for PowerPoint

Group Discussions & Team Goals Template for PowerPoint

Group Discussions & Team Goals Template for PowerPoint is a presentation template with good slide designs that you can use to prepare a presentation for teamwork and group discussion presentations.

You can use this group discussion PowerPoint template to prepare presentations on team goals. Other presentation needs require slides with metaphors on group discussions, team goals & objectives, and collaboration between different groups.

You must be logged in to download this file.

Favorite Add to Collection

Details (8 slides)

Supported Versions:

Subscribe today and get immediate access to download our PowerPoint templates.

Related PowerPoint Templates

Business Introduction PowerPoint Template

5-Item Goal Target PowerPoint Template

Get Keep Grow Model PowerPoint Template

Employee Appreciation PowerPoint Template

Create moving, zooming presentations that grab attention and keep it.

Appear right alongside your content while presenting to your audience.

Make stunning interactive charts, reports, maps, infographics, and more.

You're about to create your best presentation ever

Group Discussion Powerpoint Template

Group Discussion

Transcript: Be alert and show interest in what others say Group discussion What? What did you say? I strongly object Gd Vs Debate A debate is a perfect situation for expressing intense emotions Time Management Initiation/Introduction Pardon me Could you please repeat Team skills Self confidence Conclusion Techniques Initiation techniques I suggest Initiate one only if you have in-depth knowledge about the topic at hand Take an initiative to summarize Group Discussion has turned out to be the most important recruitment tool. GD helps recruiters to find the right candidate with min time. It help companies for mass elimination. GD is not a wrestling match It is better to begin a GD by stating quotes, facts & stories Summarization/conclusion Body language Here the candidate speaks either for or against the statement How to make a good impression Here the candidate speaks both for the statement & against the statement Knowledge Let me explain Please listen to me Keep eye contact on every member of the group when you speak Ability to present your views logically I think We can start GD even from void (cc) photo by Franco Folini on Flickr Why Group Discussion? Bring out a proper solution Initiating a GD is a high profit-high loss strategy Body Expression of your point of view and respecting another's point of view GD, however, calls for a lot more maturity and logic Gd Fundas ,But Be audible Communication skills Either winning or losing I would like to share my views Contribute statements of facts wherever necessary The core Maintain a good body language Content of a GD I beg to differ with you Be natural & at your normal self Conclude only if you are confident or 'I disagree Do's & Dont's I recommend Listening ability What can i do? (cc) photo by Metro Centric on Flickr Debate Beware Do not add new points while concluding Do not stammer/ stutter/ quote wrong facts and figures Do not consume much time for concluding Make a good and attractive beginning What does Gd test you in? Be friendly and cheerful You don't understand

GROUP DISCUSSION

Transcript: First Phases Second Phase Communication Skills - Active Listening. Non Verbal Communication. Leadership. Reasoning. Ability to influence. Innovation, Creativity & Lateral thinking. Flexibility Third Phase Avoid raising new points. Avoid stating only your viewpoint. Avoid dwelling only on one aspect of the GD. Keep it brief and concise. It must incorporate all the important points that came out during the GD. If the examiner asks you to summaries a GD, it means the GD has come to an end. Do not add anything once the GD has been summarized. Introduction Body Conclusion Most GDs do not really have conclusions. A conclusion is where the whole group decides in favor or against the topic. But every GD is summarized. You can summaries what the group has discussed in the GD in a nutshell. Body of the group discussion Points to keep In mind Conclusion of the group discussion When you initiate a GD, you not only grab the opportunity to speak, you also grab the attention of the examiner and your fellow candidates If you can make a favourable first impression with your content and communication skills after you initiate a GD, it will help you sail through the discussion. When you start a GD, you are responsible for putting it into the right perspective or framework. So initiate one only if you have indepth knowledge about the topic at hand. GROUP DISCUSSION 3 Phases in GD Quotes Definition Question Shock statement Facts, figures and statistics Short story General statement Summarization Techniques Initiation Techniques Different Techniques To Initiate a GD PARAMETERS

Transcript: Ruby a. I choose Japanese as my second language. I apply cognitive strategies when I review the lesson. I practice each word’s pronunciation. Also, I would write each new vocabulary. b. To make sure I remember those new words, I would prepare a paper and try to write those words. If I can’t write some word, then I will know I didn’t really learn it. If you are now taking a foreign language, you are becoming quite aware of your own learning processes. (a) In previous language learning experiences, how overtly aware were you of factor like ” good language learner” characteristics, your own styles, and strategies you could consciously apply? (b) What would you have done differently then, knowing what you know now? (c) What can you do differently in a current language learning situation, given what you now know from reading this chapter on styles and strategies? c. After reading this chapter, I think a study group might be a good choice. In study group, we can practice conversation together or discuss those parts we don’t understand. Also, we can cheer each other up when we feel depressed to learn. Astrid & CAROL Carol a. The characteristic tend to be high in ambiguity tolerance could acquire foreign language easier to low in ambiguity tolerance. Moreover, “Field independence” people are better in writing and reading through the traditional classroom type of learning, like test and drill. However, they are relatively poor in speaking and listening because of their reflective style of learning. “Field dependence” people are reverse. Their talent in speaking and listening could be performed through the face-to-face communication of teaching method. My own style of learning are “FD”, "low ambiguity tolerance”, auditory and kinesthetic, left-brain dominance. On learning foreign language, the strategy I can consciously apply is cognitive style included repetition, note taking, imagery. The strategy I apply in communication is affective style. Answers from Group Members Elwen c. Social strategy- cooperating with others in my learning process. I should make conversation with friends. Olivia b. Because I was shy, so I would try to apply socioaffective strategies like cooperating with peers or asking teachers or foreigners for repetition, explanation and etc. c. Now I want to apply metacognitive strategies to learn new language, because I consider that self-regulated learning is quite important for language learners. By doing so, learners can take charge of the learning process and progress clearly. Group Members: 41028254Elwen 410282024 Ruby 410282009 Olivia 410282014 Lisa 410181011 Astrid 410181016 Carol Lisa Group Discussion Question 5 b. Apply them on my daily life, including writing diary or conversation to make sure I can completely know how to express properly. b&c. I would try to enhance the level of ambiguity tolerance by being brave and confident. Besides, my learning strategies have to be adjusted because what an individual can do is very limited. Socioaffective strategies must be applied because I could benefit from cooperation with getting feedback and pool information. Moreover, I have ignored the metacognitve strategies before. When a problem came up, I hope the problem could be resolved quickly. Thus, I have my strategies to resolve the problem, but fatally I was unable to achieve it because what I lack are not the strategies toward problems, but the abilities of solving problems. About my communication strategies, I would feel anxious and ashamed of wrong speaking. The emotion stand as a great and rooted obstacle to me so I think the affective strategies are most critical to me because I need to face my emotional problem. c. After reading this chapter, I think what I lacked is autonomy and taking actions. I knew that if I want to learn Spanish well I have to keep practicing but I have seldom done it . From now on, I will do more practice during the class and after the class by reviewing and listening to improve my speaking and reading skills. Lisa a. I like to learn languages through music and movies. I used to print out lyrics or writing down dialogues, trying to sing along with the music a. I am learning Spanish now with the application of metacognitive and social strategies. When in class I will try to pay full attention, and respond to teacher’s questions actively. I will also ask other classmates to figure out when I confused about what was taught. b. After this process of awareness, I found that, for now, all I have applied are all indirect strategies. Maybe I should also use some direct strategies to help me learn Spanish, such as analyzing and reasoning( cognitive strategies) and overcoming limitations in speaking and writing (compensation strategies). Ruby Question 5 a. Actually, we didn’t so overtly aware of these (…characteristics& style& strategies…) before. But we still had some ideal “good language learners” characteristics, like: paying high attention, good at thinking and associating,

Transcript: What do you think self harm is? How would you define it? Quick Video Definition of Self Harm This is a video about a person's actual account with self harm and as well as a professional perspective: Feel free to use your journal to record any thoughts and feelings about the video. What are your thoughts about the first overall session? Do you have any questions about the journals or the program? See you Thursday! Open Discussion Period Group Discussion The Mayo Clinic describes self harm "Self -injury, as called self-harm, is the act of deliberately harming your own body, such as cutting or burning yourself. Its typically not meant as a suicide attempt. Rather self-injury is an unhealthy way to cope with emotional pain, intense anger, and frustration".

Group discussion

Transcript: Ask me! Group discussion Learning Objective: To be active participators in group discussion To be able to identify different roles within group discussion Next lesson we will... Start to look at punctuation within our writing Pair 1 = Pete (A) and Tom (B) Pair 2 = Gavin (A) and Cameron (B) 1)Partner A - you have to ask partner B: Have you got any pets at home? 2)Partner B- you have to tell the answer to your partner. 3)Partner A- you have to tell the whole group Partner B's answer Pair 1, then pair 2 ("My partner (name) has got (3 cats) at home/has not got any pets at home") Then... Swap over so partner B asks questions, Partner A answers. Repeat this process with the following questions: 1)What is your favourite colour? ("My partner's favourite colour is...") 2)What did you eat for dinner yesterday? ("My partner ate.... for dinner yesterday") 3) Do you prefer summer or winter? ("My partner prefers..... to ...... ") Group discussion designed by Péter Puklus for Prezi When we are taking part in a discussion... What should you do in a group discussion? When you are the listener... What roles do people take in a discussion? When you are the speaker... In my case... It's important to... Focus on the person who is speaking - You will understand more if you look at the person who is talking (it also shows them that you are listening) Eye contact - this is part of focus and shows you are engaged in the discussion (this is also important if you are the speaker) Avoid fiddling with anything near you - tapping a pen, or rocking on your chair or even chatting to another person (it's really hard to be the speaker whilst people are doing these things, think about how the speaker might feel) Body language Listen carefully and choose the most appropriate answers Should they speak formally or informally for each situation? Formal...Informal? http://www.bbc.co.uk/skillswise/game/en37spea-game-say-what Put your listening skills to the test... We should be... considerate - respecting other people's right to their opinions positive - helping the conversation develop by bringing other people in balanced - helping to resolve differences that may be bringing a discussion to an end Doctor : http://www.bbc.co.uk/skillswise/game/en34type-game-casualty-challenge-doctor Nurse : http://www.bbc.co.uk/skillswise/game/en34type-game-casualty-challenge-nurse Paramedic : http://www.bbc.co.uk/skillswise/game/en34type-game-casualty-challenge-paramedic So this lesson we... Looked at why we use group discussion and what structure that can take. What are the expectations of a group discussion? TO: Tom, Gavin, Pete and Cameron Newton Abbot college , E1 Eye Contact - looking at the person who is speaking or at the person you are speaking to. This will help you and the other person to respond to what they say using your body language Direct questions at particular people - If you think someone particular would start a good discussion from your point, then try this. Also this means picking different people for different topics- not just the same person for ALL topics Suggesting that everyone listens to a quieter member of the group - some of us do not speak loudly naturally so we must all consider this person when they are speaking to the group. How would you react...? Writing Intervention You are going to make a list of items to go in a suitcase you are taking on holiday. The first person who starts says... "In my case there is a...." The next person after that must say all of the items the person before them has said before in the correct order. If you are last, that means you have to say all of the items that EVERYONE has said. During group discussion, when it is your turn try to consider the following points: Make sure you begin your answer as clearly as possible - a good starter is "I think that...." then go on to explain WHY you think that. Speak as clearly as possible - this does NOT mean loud, but make sure you are not mumbling so others cannot hear you. Think about your body language - try to send out the right message to listeners, even if you are not feeling confident, your body language can help you 'fake it 'til you make it' (e.g. nodding in agreement, or throwing up your hands in dramatic disagreement). Try to keep your answers short and sweet - Long enough to explain your point, but try not to add any information that is not linked directly to the topic. Do not interrupt someone else talking - even if you disagree, try to save your response for when it is your turn.

Transcript: Cooperative Organized Group Discussion Interactive by: Hannah Esparza with Ayden Hayes Focus

Transcript: So, what would a good solution look like? Time to throw out some problem-solvers! The End The next thing we did was brainstormed all the reasons that adjusting is difficult and agreed that is both a social AND academic issue. We easily agreed on: All the members in the group were freshmen, so we picked a problem we could relate to. Criteria Getting down to business! Solutions The Path of Our Group Discussion Set Backs On The Trip? What can be done at Fairmont State University to help students make the transition from high school to college? Based on all of our evidence, the criteria we set, and the potential solutions, we chose out final answer. Day One Defining the Problem Finally, we brought all the ideas to the table that could potentially fix the transitioning problem for freshmen. We made sure to refer to our criteria to stay on the right track. And the verdict is... Final Conclusion We then set out to lay out all the things that a good solution would fix. We dug deep into our own experiences and what we thought would really help the problem. Our group met to decide which issue we wanted to conquer.

powerpoint template

Transcript: Nobody knows babies like we do! Quality products . Good Customer service. Every Kid really loves this store.. BABYLOU ABOUT US About Us BabyLou was established in 2004. It has been more than a decade since we started, where we have ensured to take care of every need and want of every child and infant under one roof, true to the caption “NO BODY KNOWS BABIES LIKE WE DO”. Our benchmark is to provide 100% customer service and satisfaction and continue to deliver the same with a wide range of toys, garments and Baby Products. Play and Create We Are Best 01 02 03 Block games Building Blocks help Kids to use their brain. PLAY TO LEARN in Crusing Adventures Our Discoveries Enjoy a sunny vacation aboard a luxury yacht with the LEGO® Creator 3in1 31083 Cruising Adventures set. This ship has all the comforts you need, including a well-equipped cabin and a toilet. Sail away to a sunny bay and take the cool water scooter to the beach. Build a sandcastle, enjoy a picnic, go surfing or check out the cute sea creatures before you head back to the yacht for a spot of fishing. Escape into the mountains Disney Little Princes in Also available for your Babies..... Also... Out of The World… Our reponsibility BABYLOU…. Our Responsibility All children have the right to fun, creative and engaging play experiences. Play is essential because when children play, they learn. As a provider of play experiences, we must ensure that our behaviour and actions are responsible towards all children and towards our stakeholders, society and the environment. We are committed to continue earning the trust our stakeholders place in us, and we are always inspired by children to be the best we can be. Innovate for children We aim to inspire children through our unique playful learning experiences and to play an active role in making a global difference on product safety while being dedicated promoters of responsibility towards children.

Explore our templates for more presentation inspiration

Marketing Proposal Template for Powerful Presentations | Prezi

Description: Catch the eye and engage the imagination with this cool-looking Prezi proposal template. The bold, bright design and highly dynamic theme all but guarantee success for your next sales or marketing proposal. All Prezi presentation templates are easily customized.

Sales KickOff - Rocket

Description: The sky’s the limit. Boost your new sales initiative into orbit with an engaging and compelling SKO presentation. This template features a effective sales kickoff theme that makes it easy to be engaging. Like all Prezi SKO templates, it’s fully customizable with your own information.

Customer Stories - Office

Description: Storytelling is at the heart of great service. Use this stunning, customizable business presentation template to highlight employees who do exceptional work or position your customers as the heroes of your business.

Quarterly Business Review - Downtown

Description: Add some color to your quarterly business review with this vibrant business presentation template. The bold visuals in this business template will make your next QBR a memorable one.

Now you can make any subject more engaging and memorable

• The Science
• Conversational Presenting
• For Business
• For Education
• Testimonials
• Presentation Gallery
• Video Gallery
• Design Gallery
• Our Customers
• Company Information
• Prezi Support
• Prezi Classic Support
• Hire an Expert
• Data Visualization
• Infographics

April 4, 2024

March 30, 2024

March 29, 2024

• Latest posts

© 2024 Prezi Inc. Terms

• Free Sign Up

Learn more how to embed presentation in WordPress

10 Presentations

Published Jan 15, 2014 in Education Direct Link : http://slideonline.com/presentation/8024-group-discussion-ppt-1 -->

GROUP DISCUSSION.ppt... Read more

Copy and paste the code below into your blog post or website

Embed into WordPress ( learn more )

Other Slide by

Steffanie & jan hospitals presentation pptx.

Published April 13, 2013 under Progamming

Published April 13, 2013 in Progamming

Presentation Slides & Transcript

GROUP DISCUSSION Mrs. Nancy Prasanna Joseph

WHAT IS GROUP DISCUSSIONA GD is a methodology used by an organization to gauge whether the candidate has certain personality traits and/or skills that it desires in its members.

PERSONALITY TRAITSAbility to work in a team  Communication skillsReasoning abilityLeadership skillsInitiativeAssertivenessFlexibilityCreativityAbility to think on ones feet

TYPESFactual TopicsControversial Topics Abstract Topics 

WHY DO WE HAVE GD?understand a subject more deeplyimproves your ability to think criticallysolving a particular problemgroup to make a particular decisionchance to hear other students' ideasimproves your listening skillsincreases your confidence in speakingchange your attitudes

What skills are judged in group discussion?How good you are at communication with othersHow you behave and interact with groupHow open minded are youYour listening skillsHow you put forward your viewsYour leadership and decision making skillsYour analysing skills and subject knowledgeProblem solving and critical thinking skillsYour attitude and confidence

Strategies for Improving GD SkillsObservePracticeParticipate Attend as many seminars and notice what other students do. Ask yourself:How do other students make critical comments? How do they ask questions? How do they disagree with or support arguments? What special phrases do they use to show politeness even when they are voicing disagreement? How do they signal to interrupt, ask a question or make a point?

Do’s Be as natural as possibleA group discussion is your chance to be more vocalTake time to organize your thoughtsSeek clarificationOpening the discussion is not the only way of gaining attention and recognitionYour body language says a lot about you

Do’sBe assertive not dominatingAlways be politeTry to avoid using extreme phrases like:`I strongly object' or `I disagree'. Instead try phrases like: `I would like to share my views on…' or `One difference between your point and mine…' or "I beg to differ with you“Brush up on your leadership skillsMotivate the other members of the team to speak

Do’sApart from the above points, the panel will also judge team members for their alertness and presence of mind, problem-solving abilities, ability to work as a team without alienating certain members, and creativity.

Don’tsLose your temper. A discussion is not an argument.Shout.Use too many gestures when you speak. Gestures like finger pointing and table thumping can appear aggressive.Dominate the discussion. Confident speakers should allow quieter students a chance to contribute.

Don’tsDraw too much on personal experience.Interrupt. Wait for a speaker to finish what they are saying before you speak.

How to face GD?A group discussion consists of:Communication Skills Knowledge and ideas regarding a given subject Capability to co-ordinate and lead Exchange of thoughts Addressing the group as a whole Thorough preparations

Initiation Techniques Body of the group discussion Summarization/ Conclusion

GD Tips - Initiation TechniquesInitiating a GD is a high profit-high loss strategy.When you initiate a GD, you not only grab the opportunity to speak, you also grab the attention of the examiner and your fellow candidates.If you can make a favourable first impression with your content and communication skills after you initiate a GD, it will help you sail through the discussion.

GD Tips - Initiation TechniquesBut if you initiate a GD and stammer/ stutter/ quote wrong facts and figures, the damage might be irreparable.If you initiate a GD impeccably but don't speak much after that, it gives the impression that you started the GD for the sake of starting it or getting those initial kitty of points earmarked for an initiator!When you start a GD, you are responsible for putting it into the right perspective or framework. So initiate one only if you have in-depth knowledge about the topic at hand.

GD Tips - Body of the group discussionDifferent techniques to initiate a GD and make a good first impression:i. Quotesii. Definition iii. Questioniv. Shock statementv. Facts, figures and statisticsvi. Short storyvii. General statement

GD Tips - Summarization/ ConclusionMost GD do not really have conclusions. A conclusion is where the whole group decides in favor or against the topic. But every GD is summarized. You can summaries what the group has discussed in the GD.

Keep the following points in mind summarizing a discussion:Avoid raising new points. Avoid stating only your viewpoint. Avoid dwelling only on one aspect of the GD. Keep it brief and concise. It must incorporate all the important points that came out during the GD. If the examiner asks you to summaries a GD, it means the GD has come to an end. Do not add anything once the GD has been summarized.

More Presentations

Published Jan 15, 2014

Copyright © 2024 SlideOnline

All slide content and descriptions are owned by their creators.

SlideOnline is an easy way to instantly publish presentations online and share on all popular social websites.

• Privacy Policy & Terms

Four Henderson McNair Scholars give presentations at national conference

During a visit to nearby Washington D.C., the students had an opportunity to visit with Arkansas U.S. Sen. John Boozman.

Four McNair Scholars from Henderson State University gave oral and poster presentations at the National Conference for McNair Scholars and Undergraduate Research held March 14-17 in College Park, Maryland.

Attendees participated in panel discussions and research workshops, and heard presentations by prestigious keynote speakers.

“Our scholars gained valuable experience presenting and discussing research with their peers,” said Reo Cummings, director of the Ronald E. McNair program at Henderson. “The students received peer reviews and presentation feedback, and fielded questions about their research. This was a valuable opportunity for them to gain experience in a collegial, supportive setting.”

The students who presented include: Otisha Burton – “Patient-Centered Care and Satisfaction in Oncology” Zoie /Autrey – “Highway Bridge Nesting Use Among Cliff Swallows in Arkansas” Alexandrea McClendon – “Process and benefits of Dry Needling” Bobbi Bazzle: “Racial Profiling, Police Brutality, and Shifting Perceptions”

Other Henderson McNair scholars who attended were Bessie Dixon, Mariya Sasser, Bridani Diaz, and Sally Santillan. They were accompanied by Cummings and Dr. Don Kelly, faculty/McNair research technical advisor.

The Ronald E. McNair Post Baccalaureate Achievement Program assists low-income, first generation college students and those from underrepresented groups in preparing for graduate education.

Henderson’s McNair Scholars Program is federally funded and serves 25 undergraduates per year.

For more information, go to hsu.edu/mcnair .

Group DISCUSSION

Oct 09, 2014

8.5k likes | 21.01k Views

Group DISCUSSION. Topics. Definition of Group Discussion Group Discussion Prerequisites of a Group Discussion Benefits in Group Discussion Salient features Do’s and Don’ts in Group Discussion Important points in Group Discussion Accept criticism Suggestion

Share Presentation

• group discussion
• leadership skills
• practice group discussion
• extensive knowledge base related

Presentation Transcript

Topics • Definition of Group Discussion • Group Discussion • Prerequisites of a Group Discussion • Benefits in Group Discussion • Salient features • Do’s and Don’ts in Group Discussion • Important points in Group Discussion • Accept criticism • Suggestion • Topics of importance frequently discussed

Definition of Group Discussion • Group Discussion is a modern method of assessing students personality. • It is both a technique and an art and a comprehensive tool to judge the worthiness of the student and his appropriateness for the job.

Group Discussion • The term suggests a discussion among a group of persons. • The group will have 8 & 12 members who will express their views freely, frankly in a friendly manner, on a topic of current issue. • Within a time limit of 20 to 30 minutes,the abilities of the members of the group is measured.

Prerequisites of a Group Discussion • Topics given by panelists • Planning and preparation • Knowledge with self-confidence • Communication skills/ power of speech • Presentation • Body Language and personal appearance • Being calm and cool

Prerequisites of a Group Discussion • Extensive knowledge base related to state, country and globe. • Areas are politics,sports,science &trade commerce,Industry and Technology,MNC,ect. • Analyze the social,economical issues logistically . • Listening skills • Co-operation.

Benefits in Group discussion • Stimulation of thinking in a new way. • Expansion of knowledge • Understanding of your strength and weakness. • Your true personality is revealed and qualities of leadership crystallize

Benefits of group discussion • provides chance to Expose • Language skills • Academic knowledge • Leadership skills • people handling skills • Team work • General knowledge.

Salient features of G.D • Topic may be given to judge your public speaking talent. • Discussion revolves around a specific subject. • The examiner does not interfere once he announced the topic. • Maintain cordiality and free expression of thought and opinion.

Do`s in group discussion • Appropriate to the issue . • Make original points & support them by substantial reasoning . • Listen to the other participants actively &carefully. • Whatever you say must be with a logical flow,&validate it with an example as far as possible. • Make only accurate statements.

Do`s in group discussion • Modulate the volume, pitch and tone. • Be considerate to the feelings of the others. • Try to get your turn. • Be an active and dynamic participant by listening. • Talk with confidence and self-assurance.

Don’ts during group discussion • Being shy /nervous / keeping isolated from G.D • Interrupting another participant before his arguments are over • Speak in favour ; example:Establish your position and stand by it stubbornly • Changed opinions • Don’t make fun of any participant even if his arguments are funny.

Don`ts during group discussion • Don’t engage yourself in sub-group conversation. • Don’t repeat and use irrelevant materials. • Addressing yourself to the examiner. • Worrying about making some grammatical mistakes,for your interest the matter you put across are important.

Important points in group discussion • Be assertive: An assertive person is direct , honest careful about not hurting others ‘self-respect’. • A patient listener: listening to another person is one way of showing appreciation. • Right language : Words can make friends & right words at the right time make the best results. • Be analytical and fact-oriented : It is necessary to make relevant points which can be supported with facts and analyzed logically.

Accept criticism • If any member of the group criticizes or disapproves a point, it is unwise to get upset or react sharply. • In case the criticism is flimsy,the same can be pointed out politely. • Maximize participation ; one must try to contribute fully, vigorously & steadily throughout the discussion. • Show leadership ability: A group discussion also evaluates your leadership qualities.

Accept someone's point of view • Praise the argument Example: Remedial English communication is necessary for college students because they fail in communication skill test. Status of literacy of women , is increased from 30% to 70% when compared to past years, in employment sectors organized ,in the IT & ITES field.

Accept the contradicts view • Express your argument with few facts, cases, %, Newspapers publications etc. • Express without hurting others feelings.

Suggestions • Never try to bluff. • Practice group discussion with friends on different subjects. • Remember !speech is a powerful weapon.

Topics of Importance frequently discussed • Is India Shining • Mobile phones / Internet – a boon or nuisance • Students focusing on software industry-good or bad • Child marriage • India 2020 • Daughters are more caring than sons • Influence of western culture in Indian Universities • Influence of computers in medical sciences

• More by User

Group Discussion

Group Discussion. Group Discussion. Groups of 8-10 candidates are formed into a leaderless group, and are given a specific situation to analyze and discuss within a given time limit, which may vary between ten minutes and forty-five minutes, or

1.3k views • 11 slides

702 views • 16 slides

halfmantr provides best of the study material about civil services. The mentor advice, blogs, tips and tests about civil services exam are absolutely free.

408 views • 1 slides

Group Discussion. Characteristics of Groups. In groups… Members interact Members become interdependent Members share norms, values, roles Members share a collective identity. Group Size. Three….to 12 (upper max for effective interaction). Advantages to Groups.

340 views • 9 slides

Group Discussion. Explain what it means to say that main effects and interactions are all independent . Describe what it means to say that order effects are “symmetrical” or “asymmetrical ?” Describe how a second factor can be used to reduce the variance in a between-subjects experiment.

664 views • 22 slides

Group Discussion. Blood Drives at BCCs. Opening up of more blood collection centres in Singapore Conversion of external blood drives to centres. Blood Buddy Programme. Volunteer training programme

202 views • 5 slides

GROUP DISCUSSION

GROUP DISCUSSION. Group Behaviors. Task functions – Getting the job done Initiating Energizing Contributing Standard Setting Information Giving Information Seeking Consensus Testing Summarizing Clarifying Evaluating Opinion Giving Opinion Seeking.

314 views • 8 slides

GROUP DISCUSSION. Group Discussion-Definition.

416 views • 22 slides

Group Discussion. General English and Soft Skills Classes Day 10 Vipul R. Solanki. Group Communication. The communication takes place among number of people As number of people are involved in GC, it demands extra care for the effective delivery of the message; Common Language

1.16k views • 38 slides

Group Discussion. Original ideas Clarity in articulation Good listening skills Positive body language. Desired Parameters in Candidates. Candidates’ group behaviour is checked on the following parameters:. Group Behaviour. Participation Leadership qualities Problem-solving capability

431 views • 21 slides

Group Discussion. Identify the basic steps in the scientific method and describe how the scientific method is used to answer questions such as, “Why are some marriages successful and others are not?”

446 views • 29 slides

GROUP DISCUSSION. CLIMATE DYNAMICS – ALICE GRIMM CLIMATE CHANGE - IRACEMA CAVALCANTI REGIONAL CLIMATE MODELING – JEREMY PAL AND ROSMERI ROCHA. CLIMATE DYNAMICS.

253 views • 4 slides

Group Discussion. Every Friday. Jerry Group. Ouk Dinaka Chem Vichai Phen Mab Roeun Sokhon Sreng Samol. Dragonfly Group. Yav Kanitha Ong Votha Pros Phearith Chhean Kong Rin Sophearun. Banteay Meanchey Group. Mot Narin Keo Vichtyear Lem Baing Tan Sambolina Mas Chann Yem Chak.

213 views • 5 slides

Group Discussion. Discussion Formats. An informal discussion that takes place before an audience. Panel members, often three or four in the panelists talk directly to each other, but each may make a short introductory speech.

472 views • 17 slides

Group Discussion. Malcolm X Chapters 9, 10, and 12. Chapter 9 NB 34. Skim through the chapter Record 1 quote that you think is insightful and explain why it is important Generate 3 discussion questions Your questions should not be plot based (ex: What is the name of Malcolm’s girlfriend?)

424 views • 5 slides

Group Discussion. Describe the similarities and differences between experiments , non-experiments , and quasi-experiments. Actions for Describe the similarities and differences between experiments and non-experiments or quasi-experiments.

584 views • 31 slides

Group Discussion. Group Discussion. GD is a simulated exercise to see what kind of leadership quality emerge from a prospective candidate. Objectives: You should be noticed by the panel You should be able to be assertive not aggressive.

874 views • 24 slides

Group Discussion. Guyana, The Bahamas T & T, Jamaica Barbados, Haiti Suriname, Curacao. Successes (1). Reduction of deaths due to care and treatment Increased HIV testing E.g. increased VCT centers in Barbados Decrease incidence of mother to child transmission

392 views • 10 slides

Group discussion

Group discussion . Name this protein. Protein sequence, from Aedes aegypti automated annotation. >25558.m01330 MIHVQQMQVSSPVSSADGFIGQLFRVILKRQGSPDKGLICKIPPLSAARREQFDASLMFE REPWFYERILPEFEAYQRAKGVGERDGFVAYAKSYVAYYKSMDQGTVLVMEDLGRRGFRM

624 views • 16 slides

1.29k views • 33 slides

GROUP DISCUSSION. WHAT IS GROUP DISCUSSION?. Group Discussion is a modern method of assessing students personality. It is both a technique and an art and a comprehensive tool to judge the worthiness of the student and his appropriateness for the job.

2.34k views • 20 slides

601 views • 29 slides

• Resource Collection
• State Resources

Community for Adult Educators

We've updated LINCS Courses.   Please see the Course Guide for updated information on using the site.

• Public Groups
• Micro Groups
• Recent Activity
• English Language Acquisition
• Discussions

Bilingual universities in the US

Hello colleagues, Jennifer Gagliardi, LINCS moderator for the Civics Ed and Citizenship group just posted a recent article, "Soothing the Path for Immigrants to Finish Their College Degrees," in the LINCS Career Pathways group. I wanted to share it here, as well. In this Hechinger Report article, author Olivia Sanchez describes a new online program at Davenport University called Casa Latina that plans to offer bilingual degrees (Spanish/English) in various academic areas beginning in the fall of this year. 

This new program at Davenport is similar to another bilingual university program I've been familiar with for some time, Ana G. Mendez University (AGMU) , which started in Puerto Rico and also has campuses in three locations in Florida. Online classes are also available at AGMU.   At Casa Latina and AGMU, classes are held in English one week and in Spanish the next.  

These bilingual universities could open the door  of opportunity for many Spanish-speaking adult learners in our programs. I can share one wonderful success story. One of my former students, a medical doctor from Cuba, found her way to Ana G. Mendez University and completed a Nurse Practitioner program. She now works as a Nurse Practitioner in the Miami area. 

If you have success stories to share, please do!

Cheers, Susan Finn Miller

Moderator, English Language Acquisition Group

• Log in or register to post comments

NATO to plan long-term Ukraine aid, mulls 100-billion euro fund

• Alliance looks to put aid to Kyiv on long-term footing
• Discussions in early stages
• Mixed reactions to Stoltenberg's proposal
• Hungary among the more sceptical member states

SCEPTICISM, SUPPORT

The Reuters Daily Briefing newsletter provides all the news you need to start your day. Sign up here.

Additional reporting by Simon Lewis, Benoit Van Overstraeten, Nette Nostlinger, Geert De Clercq, Andreas Rinke and Inti Landauro; Writing by Ingrid Melander and Andrew Gray; Editing by Stephen Coates, Gareth Jones, Ros Russell and Sharon Singleton

Our Standards: The Thomson Reuters Trust Principles. , opens new tab

Thomson Reuters

Andrew Gray is Reuters' European Affairs Editor. Based in Brussels, he covers NATO and the European Union and leads a pan-European team of reporters focused on diplomacy, defence and security. A journalist for almost 30 years, he has previously been based in the UK, Germany, Geneva, the Balkans, West Africa and Washington, where he reported on the Pentagon. He covered the Iraq war in 2003 and contributed a chapter to a Reuters book on the conflict. He has also worked at Politico Europe as a senior editor and podcast host, served as the main editor for a fellowship programme for journalists from the Balkans, and contributed to the BBC's From Our Own Correspondent radio show.

Airline passengers in parts of the United Kingdom and Ireland faced travel disruption at airports on Saturday due to flight cancellations as a storm swept across both countries and left thousands of Irish homes with power outages.

Scientists fear that the season could be damaging given that Greece has just had its warmest winter on record, leaving much of the land warm and dry.

Israel launched air strikes on eastern Lebanon early on Sunday, hitting what it said were Hezbollah infrastructure sites after the armed group downed an Israeli drone over the country as both sides continue to trade fire amid escalating regional tensions.